mass spectrometry raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-03-16 and is reviewed periodically as new material appears.
Reported activity for Selank centers on anxiolytic and nootropic effects. Russian clinical reports describe use in anxiety and in cognitive or attention-related complaints. Most of this evidence comes from studies conducted by the same research groups that developed the peptide. Independent replication in other countries remains limited, and no major Western regulatory agency has approved the compound for any indication. The gap between local reports and external verification is a recurring point in discussions of the peptide.
Tuftsin, the parent structure, is a naturally occurring immunomodulatory tetrapeptide released from the Fc region of immunoglobulin G by spleen enzymes. Selank extends this four-residue sequence with three additional amino acids. The stated rationale is that the added tail slows enzymatic breakdown and may influence receptor interactions. How the full heptapeptide behaves at the molecular level is not firmly established, and proposed mechanisms often involve indirect modulation of neurotransmitter or immune signaling rather than a single defined target.
Purity assessment relies mainly on reverse-phase high-performance liquid chromatography with ultraviolet detection. Because the peptide lacks a strong chromophore, detection often uses backbone absorbance near 214 nm. Identity is confirmed by mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, comparing the measured mass against the expected value. Amino acid analysis can verify composition after acid hydrolysis. Diastereomer content and residual counterions are reported less often, although both can influence biological assays.
Lyophilized material is generally stable for extended periods when kept dry at or below minus twenty degrees Celsius. Working solutions are less stable, and common practice is to aliquot and freeze them so that repeated freeze-thaw cycles are avoided. Aqueous solutions are sensitive to pH extremes and to microbial growth, so short-term storage at refrigerator temperature is typical. Oxidation and hydrolysis are the principal degradation routes. Reconstitution with sterile water or a mild buffer is standard, and solutions should be protected from light.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic heptapeptide | Modeled on tuftsin |
| Amino acid sequence | Thr-Lys-Pro-Arg-Pro-Gly-Pro | Seven residues |
| Approximate molecular mass | Around 750 Da | Depends on counter-ion and hydration |
| Common forms | Lyophilized powder | Also described as aqueous solution |
| Primary origin of research | Russian laboratories | Mid-1990s onward |
Most published work on selank originates from a small number of research groups in the Russian Federation. A large share of that record appears in Russian-language journals, which limits access for readers who rely on English-indexed databases. Independent replication by laboratories outside the original research network is sparse in publicly available sources. This concentration of origin and language is a frequently noted feature when the compound is summarized in broader reviews of synthetic peptides.
Reported pharmacological effects center on reduced anxiety-like behavior in animal models and on measures of memory and learning. Proposed contributing mechanisms include modulation of GABAergic signaling, shifts in monoamine turnover, and changes in the activity of enzymes that degrade neuropeptides. Effects on the expression of genes linked to neuroplasticity have also been described. No single molecular target is widely accepted, and whether the behavioral findings arise from one pathway or several remains an open question.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro. It was designed as a stabilized analogue of tuftsin, a naturally occurring tetrapeptide fragment derived from the immunoglobulin heavy chain. The additional Pro-Gly-Pro segment at the carboxyl terminus is intended to slow enzymatic cleavage. The compound is usually described in the literature as a synthetic peptide with anxiolytic and cognitive-related activity, a label that reflects a research context rather than an approved therapeutic category.
Characterization of Selank in a laboratory setting relies on standard peptide methods. Reverse-phase high-performance liquid chromatography separates the target from related impurities and provides a purity figure, commonly reported as 95 percent or higher. Mass spectrometry, typically electrospray ionization or matrix-assisted laser desorption, confirms the molecular mass and helps detect truncation or modification. Amino acid analysis can verify composition when a sequence-level check is needed. These techniques together establish identity and purity for a given lot.
Lyophilized Selank, the dry powder form, is generally stored frozen at minus 20 degrees Celsius or colder for long-term keeping. The solid is hygroscopic and should stay sealed, dry, and protected from light. Once dissolved, the peptide is less stable and is usually held refrigerated at 2 to 8 degrees Celsius for short periods. Repeated freezing and thawing is avoided because it can promote aggregation and loss of activity. Buffers and pH choice also affect how long a solution remains usable.
Solubility behavior is a practical concern for handling. Selank dissolves readily in water and in common aqueous buffers, which simplifies preparation of working solutions. The choice of solvent, ionic strength, and pH can influence aggregation over time, particularly at higher concentrations. Aqueous solutions are typically sterile-filtered before use. Because stability depends on several variables, storage and handling notes should be treated as general guidance rather than fixed rules, and specific values are best confirmed against a certificate of analysis for each batch.
The compound was designed at the Institute of Molecular Genetics of the Russian Academy of Sciences during the 1980s and 1990s. The stated design goal was to retain the immunomodulatory and central nervous system activity attributed to tuftsin while improving resistance to enzymatic breakdown. Adding a proline-rich tail to the short parent peptide was a deliberate strategy, because proline residues restrict the conformations available to many peptidases. The same laboratory produced Semax, an ACTH fragment analog, and both compounds were developed in parallel as short, enzymatically stabilized peptides intended for intranasal use.
Selank is not a naturally occurring peptide and has no known endogenous counterpart in human physiology. Russian-language sources frequently call it TP-7, while English-language sources use the name Selank almost exclusively. Database indexing is uneven, partly because early reports appeared in regional journals that are not widely cataloged. Some summaries describe the material as a tuftsin analog and others as a synthetic heptapeptide; the labels overlap rather than conflict. Citing the primary sequence resolves ambiguity more reliably than the research or trade name alone.
Selank is a synthetic heptapeptide with the sequence Thr-Lys-Pro-Arg-Pro-Gly-Pro, written TKPRPGP in one-letter notation. Its structure consists of the immunomodulatory tetrapeptide tuftsin, Thr-Lys-Pro-Arg, extended at the carboxyl terminus by a Pro-Gly-Pro segment. The molecular formula is commonly given as C33H57N11O9, corresponding to a monoisotopic mass near 751.4 Da and an average molecular mass near 751.9 Da. All seven residues are proteinogenic amino acids, and the molecule carries no modified side chains or non-natural linkages.
The "d-" in the name d-ribose refers to the stereochemistry of the chiral carbon atom farthest away from the aldehyde group (C4'). In d-ribose, as in all d-sugars, this carbon atom has the same configuration as in d-glyceraldehyde.Relative abundance of forms of ribose in solution: β-d-ribopyranose (59%), α-d-ribopyranose (20%), β-d-ribofuranose (13%), α-d-ribofuranose (7%) and open chain (0.1%). For ribose residues in nucleosides and nucleotides, the torsion angles for the rotation encompassing the bonds influence the configuration of the respective nucleoside and nucleotide. The secondary structure of a nucleic acid is determined by the rotation of its 7 torsion angles. Having a large amount of torsion angles allows for greater flexibility. In closed ring riboses, the observed flexibility mentioned above is not observed because the ring cycle imposes a limit on the number of torsion angles possible in the structure. Conformers of closed form riboses differ in regards to how the lone oxygen in the molecule is positioned respective to the nitrogenous base (also known as a nucleobase or just a base) attached to the ribose. If a carbon is facing towards the base, then the ribose is labeled as endo. If a carbon is facing away from the base, then the ribose is labeled as exo. If there is an oxygen molecule attached to the 2' carbon of a closed cycle ribose, then the exo confirmation is more stable because it decreases the interactions of the oxygen with the base.
ALFA-tag, a de novo designed helical peptide tag (SRLEEELRRRLTE) for biochemical and microscopy applications. The tag is recognized by a repertoire of single-domain antibodies AviTag, a peptide allowing biotinylation by the enzyme BirA and so the protein can be isolated by streptavidin (GLNDIFEAQKIEWHE) EPEA-tag, commercially called CaptureSelect C-tag, a 4 AA peptide that is recognized by a VHH or single-domain camelid antibody which was discovered through phage display (EPEA) Calmodulin-tag, a peptide bound by the protein calmodulin (KRRWKKNFIAVSAANRFKKISSSGAL) iCapTag™ (intein Capture Tag), a self-removing peptide-based tag (MIKIATRKYLGKQNVYGIGVERDHNFALKNGFIAHN). The iCapTag™ is controlled by pH change. Typically the pH change occurs from pH 8.5 to pH 6.2 and causes release of tagless target-protein to eluent. If needed the pH shift and buffers can be optimized for protein-specific purification method (e.g., for membrane proteins detergent could be added to the buffers to increase solubility of the protein). In contrast to other protein purification methods, this method is not relaying on proteases to cleave off a tag from tag-protein complex. Instead, during elution phase since buffer pH is changed from 8.5 to pH 6.2 that triggers cleavage reaction resulting in a release of tagless target protein while highly engineered tag stays attached to the column. The expected purity of tagless target proteins or peptides is between 95-99%. The iCapTag™ contains patented component derived from Nostoc punctiforme (Npu) intein.
Dubnium is a synthetic chemical element; it has symbol Db and atomic number 105. It is highly radioactive: the most stable known isotope, dubnium-268, has a half-life of about 16 hours. This greatly limits extended research on the element. Dubnium does not occur naturally on Earth and is produced artificially. The Soviet Joint Institute for Nuclear Research (JINR) claimed the first discovery of the element in 1968, followed by the American Lawrence Berkeley Laboratory in 1970. Both teams proposed their names for the new element and used them without formal approval. The long-standing dispute was resolved in 1993 by an official investigation of the discovery claims by the Transfermium Working Group, formed by the International Union of Pure and Applied Chemistry and the International Union of Pure and Applied Physics, resulting in credit for the discovery being officially shared between both teams. The element was formally named dubnium in 1997 after the town of Dubna, the site of the JINR. Theoretical research establishes dubnium as a member of group 5 in the 6d series of transition metals, placing it under vanadium, niobium, and tantalum. Dubnium should share most properties, such as its valence electron configuration and having a dominant +5 oxidation state, with the other group 5 elements, with a few anomalies due to relativistic effects. A limited investigation of dubnium chemistry has confirmed this.
Sources: en.wikipedia.org
However, by 24 hours after the dose, unchanged EMP could no longer be detected in the circulation. The clearance of EMP from blood plasma is 4.85 ± 0.684 L/h. The volumes of distribution of EMP with intravenous injection were small; under a two-compartment model, the volume of distribution for the central compartment was 0.043 L/kg and for the peripheral compartment was 0.11 L/kg. The plasma protein binding of EMP is high. Estramustine is accumulated in tumor tissue, for instance prostate cancer and glioma tissue, with estramustine levels much higher in these tissues than in plasma (e.g., 6.3- and 15.9-fold, respectively). Conversely, levels of estromustine in tumor versus plasma are similar (1.0- and 0.5-fold, respectively). Estramustine and estromustine appear to accumulate in adipose tissue. The elimination half-life of estromustine with oral EMP was 13.6 hours on average, with a range of 8.8 to 22.7 hours. Conversely, the elimination half-life of estromustine with intravenous injection was 10.3 hours, with a range of 7.36 to 12.3 hours. For comparison, the corresponding elimination half-lives of estrone were 16.5 and 14.7 hours for oral and intravenous administration, respectively. Estramustine and estromustine are mainly excreted in bile and hence in feces. They are not believed to be excreted in urine.
== Advantage and limitations == Immunoliposomes have many possible applications as described above and have certain advantages in new research and ideas. Some advantages being researched include immunoliposomes targeting specific molecules in the body. In preclinical testing, they can be environmentally responsive to specific conditions of temperature, pH, enzymes, redox reactions, magnetic energy, and light to release drugs. This conditional ability allows immunoliposomes to focus on specific target areas which can be beneficial for drug delivery. Increased targeting allows the possibility for decreased systemic toxicity while increasing drug concentration at a certain site. Even with this advantage of immunoliposomes, there are some challenges in their application. The success of immunoliposomes during in vivo testing has been shown by multiple groups including Meeroekyai et al 2023 and animal testing has been successful in groups such as Refaat et al 2022. However, they struggle to thrive in higher level and clinical testing. This challenge stems from the variability and lack of understanding of tumors, pharmacokinetics, and large scale production of immunoliposomes. For example, tumors vary but typically have increased vascular permeability and decreased lymphatic drainage which lead to the EPR effect. EFR is the enhanced permeability and retention effect in which drug carriers depend on but the effect and environment can vary in solid tumors. This varying environment makes it hard to predict how the immunoliposome acts and quantify its pharmacokinetics.
Complexes of macromolecules occur ubiquitously in nature, where they are involved in the construction of viruses and all living cells. In addition, they play fundamental roles in all basic life processes (protein translation, cell division, vesicle trafficking, intra- and inter-cellular exchange of material between compartments, etc.). In each of these roles, complex mixtures of become organized in specific structural and spatial ways. While the individual macromolecules are held together by a combination of covalent bonds and intramolecular non-covalent forces (i.e., associations between parts within each molecule, via charge-charge interactions, van der Waals forces, and dipole–dipole interactions such as hydrogen bonds), by definition MAs themselves are held together solely via the noncovalent forces, except now exerted between molecules (i.e., intermolecular interactions).
Bats are subject to predation from birds of prey, such as owls, hawks, and falcons. J. Rydell and J. R. Speakman argue that bats evolved nocturnality during the early Eocene period to avoid predators. Other zoologists find the evidence to be unclear and contradictory. Twenty-two (maybe twenty-three or twenty-four) species of tropical New World snakes are known to eat bats; they may wait for them at the entrances of their refuges or attack them inside. As are most mammals, bats are hosts to a number of internal and external parasites. Among ectoparasites, bats carry fleas and mites, as well as specific parasites such as bat bugs and bat flies (Nycteribiidae and Streblidae). Bats generally do not host lice, possibly due to high competition from other parasites, including the more specialised ones. Internal parasites of bats include tapeworms, roundworms and flukes.
Sources: en.wikipedia.org
Selank is a synthetic peptide made of seven amino acids. It is modeled on tuftsin, a natural tetrapeptide, with an added three-residue tail. It is not a small-molecule drug.
It originates from research in Russia, associated with the Institute of Molecular Genetics of the Russian Academy of Sciences. The first descriptions date to the mid-1990s. Most published studies come from Russian laboratories.
No, Selank itself does not occur naturally. Its backbone is based on tuftsin, which is produced in the body, but the seven-residue version is a synthetic construct. It is supplied as a manufactured peptide.
Purity is usually reported as an HPLC area percentage, most often measured at 214 nm. Identity is confirmed separately by mass spectrometry. A certificate of analysis should state both the method and the observed value.